PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0188s0170.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family TALE
Protein Properties Length: 466aa    MW: 52217.7 Da    PI: 6.8728
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0188s0170.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.94.7e-103874241954
                             HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                             Fe   ++yp+++e+  LA+++gLt++qV++WF N R +
  SapurV1A.0188s0170.2.p 387 FEHflHPYPNESEKLMLASQTGLTKNQVSNWFINARVR 424
                             554459******************************88 PP

2BELL105.63.2e-34250321172
                    BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                             e++e++ k+akL+ lleeV+ rY++y++q++ v+ssFe++aglg+ak+Yt+lAl+a+S+hF  L+dai++qi
  SapurV1A.0188s0170.2.p 250 EKHEVHLKIAKLIALLEEVEGRYEKYYHQMEEVVSSFEEIAGLGAAKSYTALALQAMSKHFCKLRDAIVSQI 321
                             6799*******************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.8E-31183319IPR006563POX domain
PfamPF075267.0E-40189318IPR006563POX domain
PROSITE profilePS5007112.147365428IPR001356Homeobox domain
CDDcd000861.01E-10368429No hitNo description
SMARTSM003898.0E-10368432IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.608.9E-28373434IPR009057Homeodomain-like
SuperFamilySSF466895.56E-18373436IPR009057Homeodomain-like
PfamPF059203.0E-17385424IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 466 aa     Download sequence    Send to blast
MVSQDSSSNS ASSMLHQFII SHSISSQNQF QSQNFDAFGL NLRGSNTFPQ SHGVLPSFQS  60
LEERMSRSID LVQAPSVEQE TGISHTRHLM NLHETANETN RQTQRLSLSL GSHMLAPQVQ  120
YRQRSFNSDL ISPSYLISRE DEARETCNLE GEQGNTDYSL IGSGFPSPST SSGRRSSTAY  180
GTESLAVAIS NSRYLKPAQS LLEEIVHVSC KAVEISNEKC VRKLIRCRGS LGLSSELKAE  240
LWGNGLVHAE KHEVHLKIAK LIALLEEVEG RYEKYYHQME EVVSSFEEIA GLGAAKSYTA  300
LALQAMSKHF CKLRDAIVSQ INETRRKFSQ DLPKISSGLS KLSLFDKETK HNRSLQQLGM  360
TQSQRQAWRP IRGLPETSVA ILRSWLFEHF LHPYPNESEK LMLASQTGLT KNQVSNWFIN  420
ARVRLWKPMI EEMYKVEFAD SSEDSNPLLG SPFMAGEVVS DHSEE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A6e-17374431158Homeobox protein Meis1
4xrs_B6e-17374431158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002306891.20.0hypothetical protein POPTR_0005s25350g
SwissprotQ1PFD11e-107BLH11_ARATH; BEL1-like homeodomain protein 11
TrEMBLB9H4F90.0B9H4F9_POPTR; Uncharacterized protein
STRINGPOPTR_0005s25350.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75430.11e-108BEL1-like homeodomain 11